PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30155.m001616
Common NameLOC8277753, RCOM_1541510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family MYB_related
Protein Properties Length: 240aa    MW: 27464.7 Da    PI: 6.7175
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30155.m001616genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.9e-13118162347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
    30155.m001616 118 PWTEHEHRLFLIGLHRYGKGDWRSISRNVVITRTPTQVASHAQKY 162
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.061670IPR017884SANT domain
SMARTSM007170.00251768IPR001005SANT/Myb domain
SuperFamilySSF466898.18E-92173IPR009057Homeodomain-like
CDDcd001676.79E-42166No hitNo description
PROSITE profilePS5129418.381111167IPR017930Myb domain
SuperFamilySSF466892.3E-16113168IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-16114166IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.9E-10115161IPR009057Homeodomain-like
SMARTSM007173.6E-10115165IPR001005SANT/Myb domain
PfamPF002492.5E-11118162IPR001005SANT/Myb domain
CDDcd001676.69E-9118163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MYQENLSTRF LTQSSSARFC WNLSEEKQFE KALVQFSEDL PDRWQQIADC IGKSVQEVTE  60
HYEELVRDVN EIDSGRVELP CYRDGNSCWE SMGAVPSEIS FGGKSNKQAD SERKKGTPWT  120
EHEHRLFLIG LHRYGKGDWR SISRNVVITR TPTQVASHAQ KYFLRQNSMS MKKERKRSSI  180
HDITTVDDKP VPLPIDQSWI PPPGAPVQQL SGMQDAPMPP AGHFPNQGGS MGYQNYDFHM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1321831174RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002515769.10.0PREDICTED: transcription factor DIVARICATA
TrEMBLB9RPV00.0B9RPV0_RICCO; DNA binding protein, putative
STRINGGLYMA20G24600.11e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-67MYB family protein